PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g041420m
Common NameCISIN_1g041420mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 310aa    MW: 33479.1 Da    PI: 9.3822
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g041420mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.53.9e-403393262
             zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                       +e+alkcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk +
  orange1.1g041420m 33 QEQALKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKIK 93
                       5799******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-263191IPR003851Zinc finger, Dof-type
PfamPF027011.8E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4323791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MSSENILTTQ AVMTKEENQN PAGNRKTAST RPQEQALKCP RCDSPNTKFC YYNNYSLTQP  60
RHFCKTCRRY WTKGGALRNV PIGGGCRKNK KIKSSSRLSV DSKDSASSSE IGGFKFFHGL  120
SPAMDFQLGG LSFPRLNPSS AGICSQFSSF GDATSPSYFG LDPSASSANH PLTGFNYPLS  180
SIVANTFVEQ FKKWQQRLAM LFGGENQKET TVASAQLETQ TQKPQPILFQ NLEISSKPEA  240
PAVGNSRKEG ASGESTATEW FFGNSYAPVT AGTPTTTSSG GNGGNDNTIN NWNNGAQGWS  300
DLHRYSGLP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006426240.10.0hypothetical protein CICLE_v10026011mg
TrEMBLA0A067EZI00.0A0A067EZI0_CITSI; Uncharacterized protein
STRINGVIT_00s0218g00040.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49502850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.13e-49Dof family protein